SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377594 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377594
Domain Number 1 Region: 38-196,320-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.37e-43
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377594   Gene: ENSG00000119723   Transcript: ENST00000394026
Sequence length 443
Comment pep:known chromosome:GRCh38:14:73949926:73963108:1 gene:ENSG00000119723 transcript:ENST00000394026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQGPPLSSFGVWLASRAASDPSRPRRQGYDIHFHDKKILLLEAGPKKVLEKLSETYSN
RVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVEN
DVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQTKLLI
GADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSGPIALLPLSDT
LSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSDADHTDFIDTAGAMLQYAVSLLKPTK
VSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGD
ISSLAHHLSTAAFNGKDLGSVSHLTGYETERQRHNTALLAATDLLKRLYSTSASPLVLLR
TWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences ENSP00000377594 NP_872286.2.87134 NP_872286.2.92137 ENSP00000377594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]