SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000377957 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000377957
Domain Number 1 Region: 484-805
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.75e-109
Family PDEase 0.0000000000117
Further Details:      
 
Domain Number 2 Region: 95-289
Classification Level Classification E-value
Superfamily GAF domain-like 1.94e-44
Family GAF domain 0.0000786
Further Details:      
 
Domain Number 3 Region: 275-479
Classification Level Classification E-value
Superfamily GAF domain-like 1.48e-37
Family GAF domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000377957   Gene: ENSG00000138735   Transcript: ENST00000394439
Sequence length 823
Comment pep:known chromosome:GRCh38:4:119494397:119628084:-1 gene:ENSG00000138735 transcript:ENST00000394439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRP
IVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKI
FLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGH
VAALGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNG
GTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILK
KIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYA
QYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVN
KMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASA
AEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKH
EVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALS
HDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTT
LKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPW
PIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEAL
THVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN
Download sequence
Identical sequences G5E9C5
NP_246273.2.87134 NP_246273.2.92137 gi|61744432|ref|NP_246273.2| ENSP00000377957 ENSP00000377957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]