SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378709 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000378709
Domain Number - Region: 16-22,73-97,142-150,200-208
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.067
Family Di-heme elbow motif 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378709   Gene: ENSG00000099840   Transcript: ENST00000395296
Sequence length 208
Comment pep:novel chromosome:GRCh38:19:2096943:2099584:1 gene:ENSG00000099840 transcript:ENST00000395296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLCLVCLTAALAHGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDT
MKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVHLIQNA
IIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKSAVQGLLNYINNWHNL
VSPALRCLEPPHLANLTLEDAAECLKQH
Download sequence
Identical sequences A0A0A0MS61
XP_005259537.2.92137 ENSP00000378709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]