SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000379625 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379625
Domain Number 1 Region: 173-307
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-28
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-135
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379625   Gene: ENSG00000172936   Transcript: ENST00000396334
Sequence length 309
Comment pep:known chromosome:GRCh38:3:38138478:38143022:1 gene:ENSG00000172936 transcript:ENST00000396334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICY
CPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDY
LQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWT
RLAKALSLP
Download sequence
Identical sequences A0A0A0MS70
ENSP00000379625 9606.ENSP00000379625 NP_002459.2.87134 NP_002459.2.92137 gi|197276654|ref|NP_002459.2| ENSP00000379625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]