SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000379967 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000379967
Domain Number 1 Region: 63-256
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-79
Family Sec7 domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 265-380
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-34
Family Pleckstrin-homology domain (PH domain) 0.000000794
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000379967   Gene: ENSG00000008256   Transcript: ENST00000396741
Sequence length 400
Comment pep:known chromosome:GRCh38:7:6161776:6272644:-1 gene:ENSG00000008256 transcript:ENST00000396741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR
ISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences A0A096NQ83 A0A2J8R559 O43739
XP_009240803.1.23681 XP_012351774.1.23891 ENSNLEP00000001385 9598.ENSPTRP00000032293 ENSP00000379967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]