SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380426 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380426
Domain Number 1 Region: 31-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000487
Family Complement control module/SCR domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380426   Gene: ENSG00000134470   Transcript: ENST00000397255
Sequence length 252
Comment pep:known chromosome:GRCh38:10:5953260:5977492:-1 gene:ENSG00000134470 transcript:ENST00000397255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRASVCSCHPR
SAGHTCSVGSVC
Download sequence
Identical sequences ENSP00000380426 ENSP00000380426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]