SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380491 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380491
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 2.53e-40
Family Globins 0.0000000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380491   Gene: ENSG00000198125   Transcript: ENST00000397328
Sequence length 154
Comment pep:known chromosome:GRCh38:22:35606764:35617508:-1 gene:ENSG00000198125 transcript:ENST00000397328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Download sequence
Identical sequences A0A1K0FU49 P02144
NP_005359.1.87134 NP_005359.1.92137 NP_976311.1.87134 NP_976311.1.92137 NP_976312.1.87134 NP_976312.1.92137 XP_005261662.1.92137 9606.ENSP00000352835 ENSP00000380489 ENSP00000352835 ENSP00000380489 ENSP00000380491 ENSP00000384239 ENSP00000352835 ENSP00000380489 ENSP00000380491 ENSP00000384239 gi|44955885|ref|NP_976311.1| gi|44955888|ref|NP_976312.1| gi|4885477|ref|NP_005359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]