SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000380806 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000380806
Domain Number 1 Region: 26-74
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000132
Family Predicted metal-dependent hydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000380806   Gene: ENSG00000182362   Transcript: ENST00000397692
Sequence length 79
Comment pep:known chromosome:GRCh38:21:46286384:46297751:1 gene:ENSG00000182362 transcript:ENST00000397692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVIRNLQRVIPIRRAPLRSKIEIVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDEL
GRRTGTRLQPLTRGLFGGS
Download sequence
Identical sequences A0A2J8M8X0
ENSP00000380806 ENSP00000380806 NP_001300953.1.87134 NP_001300953.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]