SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381190
Domain Number 1 Region: 355-663
Classification Level Classification E-value
Superfamily Folate-binding domain 9.26e-82
Family Aminomethyltransferase folate-binding domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 2-158,263-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-36
Family FAD-linked reductases, N-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 160-262
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.1e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 4 Region: 665-758
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000018
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381190   Gene: ENSG00000090857   Transcript: ENST00000398122
Sequence length 779
Comment pep:putative chromosome:GRCh38:16:70114372:70157131:1 gene:ENSG00000090857 transcript:ENST00000398122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSNKLYYQLEQETGIQTGYTRTGSIFLAQTQDRLISLKRINAGLNVIGIPSEIISPK
KVAELHHLLNVHDLVGAMHVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKG
QVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQSS
TPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLL
RRMPELETLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGAGKYLA
EWMVHGYPSENVWELDLKRFGALQSSRTFLRHRVMEVMPLMYDLKVPRWDFQTGRQLRTS
PLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVKCCKEA
VCVIDMSSFTKFEITSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEGGGYENDCSIAR
LNKRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVLSELSY
APMTPDHFPSLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKY
GIRNAGYYALRSLRIEKFFAFWGQDINNLTTPLECGRESRVKLEKGMDFIGRDALLQQKQ
NGVYKRLTMFILDDHDSDLDLWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGFVHNF
SEDTGEEQVVTADFINRGEYEIDIAGYRFQAKAKLYPVASLFTQKRRKDDMELSDLHGK
Download sequence
Identical sequences A8MT40
ENSP00000381190 NP_001309047.1.87134 NP_001309047.1.92137 ENSP00000381190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]