SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382175 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000382175
Domain Number - Region: 462-525
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0262
Family Skp1 dimerisation domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382175   Gene: ENSG00000197535   Transcript: ENST00000399229
Sequence length 585
Comment pep:novel chromosome:GRCh38:15:52313696:52351382:-1 gene:ENSG00000197535 transcript:ENST00000399229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPKNTMTDSTILLEDVQKMK
DKGEIAQAYIGLKETNRLLESQLQSQKRSHENEAEALRGEIQSLKEENNRQQQLLAQNLQ
LPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMEN
ISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPGLPA
YILFMCVRHADYLNDDQKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQ
YSGEEGFMKHNTSRQNEHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGML
EHETIQGVSGVKPTGLRKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVK
QMFYIIGAITLNNLLLRKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQA
AQLLQVKKKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRD
RKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV
Download sequence
Identical sequences A0A2J8NSQ9 A0A2J8VBV4 E7ERV5
ENSP00000382175 ENSP00000382175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]