SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000382419 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000382419
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000382419   Gene: ENSG00000154040   Transcript: ENST00000399496
Sequence length 379
Comment pep:known chromosome:GRCh38:18:24138978:24161600:1 gene:ENSG00000154040 transcript:ENST00000399496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQML
AMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPP
KVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVP
ADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGI
AGEVTVTTAHKRRKAETEN
Download sequence
Identical sequences NP_619585.1.87134 NP_619585.1.92137 NP_722453.1.87134 NP_722453.1.92137 ENSP00000382419 ENSP00000382421 ENSP00000462811 ENSP00000382419 ENSP00000382421 ENSP00000462811 gi|24797112|ref|NP_619585.1| gi|24797116|ref|NP_722453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]