SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383362 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000383362
Domain Number 1 Region: 8-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.39e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000097
Further Details:      
 
Domain Number 2 Region: 362-493
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.12e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383362   Gene: ENSG00000184470   Transcript: ENST00000400518
Sequence length 494
Comment pep:known chromosome:GRCh38:22:19875517:19932553:-1 gene:ENSG00000184470 transcript:ENST00000400518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVG
CIPKKLMHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKSLNWGHRVQLQDR
KVKYFNIKASFVDEHTVCGVAKGGKEILLSADHIIIATGGRPRYPTHIEGALEYGITSDD
IFWLKESPGKTLVVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMAS
HGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAIGRVPDTRSLNLEKA
GVDTSPDTQKILVDSREATSVPHIYAIGDVVEGRPELTPIAIMAGRLLVQRLFGGSSDLM
DYDNVPTTVFTPLEYGCVGLSEEEAVARHGQEHVEVYHAHYKPLEFTVAGRDASQCYVKM
VCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQVMRTVGIHPTCSEEVVKLRIS
KRSGLDPTVTGCUG
Download sequence
Identical sequences ENSP00000383362 ENSP00000383362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]