SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384113 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384113
Domain Number 1 Region: 19-117
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000484
Family Rhomboid-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384113   Gene: ENSG00000100263   Transcript: ENST00000406335
Sequence length 136
Comment pep:known chromosome:GRCh38:22:29263957:29267728:-1 gene:ENSG00000100263 transcript:ENST00000406335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRP
Download sequence
Identical sequences B0QYJ2
ENSP00000384113 ENSP00000384113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]