SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384280 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384280
Domain Number 1 Region: 59-146
Classification Level Classification E-value
Superfamily Sec7 domain 1.06e-26
Family Sec7 domain 0.0000298
Further Details:      
 
Weak hits

Sequence:  ENSP00000384280
Domain Number - Region: 15-49
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.01
Family AF0060-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384280   Gene: ENSG00000100055   Transcript: ENST00000405206
Sequence length 157
Comment pep:putative chromosome:GRCh38:22:37282487:37300271:1 gene:ENSG00000100055 transcript:ENST00000405206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRFREGASDLGFGG
Download sequence
Identical sequences B1AHH6
ENSP00000384280 ENSP00000384280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]