SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384289 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384289
Domain Number 1 Region: 10-175
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000157
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384289   Gene: ENSG00000136986   Transcript: ENST00000405944
Sequence length 231
Comment pep:known chromosome:GRCh38:8:123014149:123042122:-1 gene:ENSG00000136986 transcript:ENST00000405944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF
YFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSYPMDLGGRNFL
STPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Download sequence
Identical sequences K7ARL7
gi|197927278|ref|NP_001128143.1| ENSP00000384289 ENSP00000384289 NP_001128143.1.87134 NP_001128143.1.92137 XP_001146014.1.37143 XP_003256216.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]