SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384744 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384744
Domain Number 1 Region: 11-191
Classification Level Classification E-value
Superfamily Rhomboid-like 2.88e-19
Family Rhomboid-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384744   Gene: ENSG00000099958   Transcript: ENST00000406855
Sequence length 239
Comment pep:novel chromosome:GRCh38:22:23834503:23839006:-1 gene:ENSG00000099958 transcript:ENST00000406855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFLGLQSSKAPAGSSLTIWTQQSQGGPGTAGELAAPS
Download sequence
Identical sequences ENSP00000384744 NP_001129223.1.87134 NP_001129223.1.92137 ENSP00000315303 gi|209364542|ref|NP_001129223.1| ENSP00000384744 9606.ENSP00000384744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]