SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385004 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385004
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-57
Family CRAL/TRIO domain 0.0000000415
Further Details:      
 
Domain Number 2 Region: 200-310
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.7e-36
Family Supernatant protein factor (SPF), C-terminal domain 0.000000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385004   Gene: ENSG00000100012   Transcript: ENST00000402286
Sequence length 323
Comment pep:putative chromosome:GRCh38:22:30459506:30471986:-1 gene:ENSG00000100012 transcript:ENST00000402286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDL
QTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKL
FPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTDPDGNPKCLTK
INYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPGCVLRWQFSSDGADIGFG
VFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGVYVLRFDNTYSFVHAKKV
SFTVEVLLPDEGMQKYDKELTPV
Download sequence
Identical sequences NP_001244307.1.87134 NP_001244307.1.92137 ENSP00000385004 ENSP00000439752 ENSP00000385004 ENSP00000439752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]