SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385044 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385044
Domain Number 1 Region: 44-158
Classification Level Classification E-value
Superfamily Fibronectin type III 9.07e-23
Family Fibronectin type III 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSP00000385044
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0184
Family Fibronectin type III 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385044   Gene: ENSG00000159128   Transcript: ENST00000405436
Sequence length 258
Comment pep:putative chromosome:GRCh38:21:33403466:33437502:1 gene:ENSG00000159128 transcript:ENST00000405436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVT
VGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISL
DNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLL
SVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDS
VSIISFPEKEQEDVLQTL
Download sequence
Identical sequences B5MCZ0
ENSP00000385044 ENSP00000385044 ENSP00000461231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]