SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385919 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385919
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000118
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385919   Gene: ENSG00000065371   Transcript: ENST00000405845
Sequence length 212
Comment pep:known chromosome:GRCh38:3:123969015:123992137:-1 gene:ENSG00000065371 transcript:ENST00000405845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVA
LCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHV
SRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE
Download sequence
Identical sequences A0A140VKB2 Q9HAT0
ENSP00000184183 gi|21359920|ref|NP_060048.2| 9606.ENSP00000184183 GO.101431 ENSP00000184183 ENSP00000385919 ENSP00000184183 ENSP00000385919 ENSP00000483603 NP_001304703.1.87134 NP_001304703.1.92137 NP_060048.2.87134 NP_060048.2.92137 XP_011511235.1.92137 XP_011511236.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]