SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385941 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385941
Domain Number 1 Region: 15-216
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.02e-58
Family CRAL/TRIO domain 0.0000000329
Further Details:      
 
Domain Number 2 Region: 218-303
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.4e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.00000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385941   Gene: ENSG00000100012   Transcript: ENST00000403066
Sequence length 353
Comment pep:putative chromosome:GRCh38:22:30447959:30472017:-1 gene:ENSG00000100012 transcript:ENST00000403066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQD
LLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLE
ENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPA
QFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFP
GCVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTDVLPSQRYNAHMVPEDGNLTCSEAG
VYVESESGKSCCHLPVIICSHELQNSHSNSQVMAYQMVRKCKLSRPLPLPASN
Download sequence
Identical sequences B5MC44
ENSP00000385941 ENSP00000385941 ENSP00000401864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]