SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385983 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000385983
Domain Number - Region: 21-61
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385983   Gene: ENSG00000136560   Transcript: ENST00000403609
Sequence length 119
Comment pep:known chromosome:GRCh38:2:161179621:161204979:1 gene:ENSG00000136560 transcript:ENST00000403609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Download sequence
Identical sequences ENSP00000385983 ENSP00000385983 ENSP00000415276 NP_597841.1.87134 NP_597841.1.92137 gi|19743571|ref|NP_597841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]