SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386104 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386104
Domain Number 1 Region: 50-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.77e-73
Family Pancreatic carboxypeptidases 0.000000984
Further Details:      
 
Domain Number 2 Region: 375-471
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1e-21
Family Carboxypeptidase regulatory domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386104   Gene: ENSG00000109472   Transcript: ENST00000402744
Sequence length 476
Comment pep:known chromosome:GRCh38:4:165378942:165498320:1 gene:ENSG00000109472 transcript:ENST00000402744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWED
NKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF
Download sequence
Identical sequences P16870
ENSP00000386104 9606.ENSP00000386104 ENSP00000386104 ENSP00000416601 GO.44103 gi|4503009|ref|NP_001864.1| NP_001864.1.87134 NP_001864.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]