SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386123 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386123
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.32e-27
Family Crystallins/Ca-binding development proteins 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386123   Gene: ENSG00000100053   Transcript: ENST00000404334
Sequence length 113
Comment pep:putative chromosome:GRCh38:22:25199873:25207267:1 gene:ENSG00000100053 transcript:ENST00000404334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQHGAPEQAAAGKSHGDLGGSYKVILYELENFQGKRCELSAECPSLTDSLLEKVGSIQ
VESGPWLAFESRAFRGEQFVLEKGDYPRWDAWSNSRDSDSLLSLRPLNIVGWL
Download sequence
Identical sequences B1AHR5
ENSP00000386123 ENSP00000386123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]