SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386254 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386254
Domain Number 1 Region: 181-325
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.44e-31
Family AlaX-like 0.02
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.7e-16
Family Co-chaperone p23-like 0.00094
Further Details:      
 
Domain Number 3 Region: 122-178
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000024
Family AlaX-M N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386254   Gene: ENSG00000108825   Transcript: ENST00000409103
Sequence length 495
Comment pep:novel chromosome:GRCh38:17:42950546:42979993:-1 gene:ENSG00000108825 transcript:ENST00000409103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCFV
RKWKEKVAWPRLTKEDIKLLKKVSTKRPPPAMDDLDFTTTVVSCCPAELQTEGSNGKKEV
LSGFQVVLEDTVLFPEGGGQPDDRGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRV
DWERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQS
VNEKIRDRLPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNL
SDLQVIKILGTEKGKKNRTNLIFLSGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKK
LQNSTKILQKNNLNLLRDLAVHIAHSLRNSPDWGGVVILHRKEGDSEFMNIIANEIGSEE
TLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEA
QALLQDYISTQSAKE
Download sequence
Identical sequences C9J5N1
ENSP00000386254 ENSP00000386254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]