SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386528 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000386528
Domain Number - Region: 35-88
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0237
Family Di-heme elbow motif 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386528   Gene: ENSG00000243449   Transcript: ENST00000409860
Sequence length 95
Comment pep:novel chromosome:GRCh38:4:2042050:2043964:1 gene:ENSG00000243449 transcript:ENST00000409860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRA
LQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Download sequence
Identical sequences Q5BLP8
ENSP00000386528 ENSP00000386528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]