SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386539 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386539
Domain Number 1 Region: 247-556
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.47e-115
Family PDEase 0.0000000769
Further Details:      
 
Domain Number 2 Region: 24-226
Classification Level Classification E-value
Superfamily GAF domain-like 6.28e-43
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386539   Gene: ENSG00000128655   Transcript: ENST00000409504
Sequence length 575
Comment pep:known chromosome:GRCh38:2:177629047:177922795:-1 gene:ENSG00000128655 transcript:ENST00000409504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLL
KCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAEL
VASTGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKP
FDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAA
NIPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNY
RMVLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAK
SGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLT
LYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEF
FEQGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSV
ATNRSKWEELHQKRLLASTASSSPASVMVAKEDRN
Download sequence
Identical sequences NP_001070826.1.87134 NP_001070826.1.92137 XP_008966749.1.60992 gi|116536089|ref|NP_001070826.1| ENSP00000386539 ENSP00000390599 ENSP00000386539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]