SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386621 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386621
Domain Number 1 Region: 272-416
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-31
Family AlaX-like 0.02
Further Details:      
 
Domain Number 2 Region: 47-172
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.28e-28
Family Co-chaperone p23-like 0.00011
Further Details:      
 
Domain Number 3 Region: 213-269
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000307
Family AlaX-M N-terminal domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386621   Gene: ENSG00000108825   Transcript: ENST00000409399
Sequence length 586
Comment pep:known chromosome:GRCh38:17:42950530:42980490:-1 gene:ENSG00000108825 transcript:ENST00000409399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYV
FMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKDSQDKRSSRSITCF
VRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPP
PAMDDLDFTTTVVSCCPAELQTEGSNGKKEVLSGFQVVLEDTVLFPEGGGQPDDRGTIND
ISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADHLFKLK
TTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGR
GLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNRTNLIFLSGNRV
LKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIAHSLRN
SPDWGGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLG
PRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Download sequence
Identical sequences gi|217416402|ref|NP_001129514.2| ENSP00000386621 ENSP00000409924 ENSP00000386621 ENSP00000409924 ENSP00000386254 NP_001129514.2.87134 NP_001129514.2.92137 9606.ENSP00000386621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]