SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386828 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386828
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 8.7e-87
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-23
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000204
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 4 Region: 511-598
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000432
Family Integrin beta tail domain 0.0025
Further Details:      
 
Domain Number 5 Region: 80-155
Classification Level Classification E-value
Superfamily Integrin domains 0.0000141
Family Integrin domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386828   Gene: ENSG00000115221   Transcript: ENST00000409967
Sequence length 681
Comment pep:novel chromosome:GRCh38:2:160101685:160200258:-1 gene:ENSG00000115221 transcript:ENST00000409967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPN
IPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTS
TFKNVTYKHREKQKVDLSTDC
Download sequence
Identical sequences ENSP00000386828 NP_001269284.1.87134 NP_001269284.1.92137 ENSP00000386828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]