SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386923 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386923
Domain Number 1 Region: 22-194
Classification Level Classification E-value
Superfamily Lysozyme-like 3.37e-18
Family G-type lysozyme 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386923   Gene: ENSG00000144214   Transcript: ENST00000409448
Sequence length 194
Comment pep:known chromosome:GRCh38:2:99284257:99304742:-1 gene:ENSG00000144214 transcript:ENST00000409448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEI
DMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTS
WISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCN
DVLARAKYLKRHGF
Download sequence
Identical sequences Q8N1E2
9606.ENSP00000311320 gi|28372527|ref|NP_777558.1| ENSP00000311320 ENSP00000386923 NP_777558.1.87134 NP_777558.1.92137 XP_005263926.1.92137 XP_005263927.1.92137 XP_005263928.1.92137 XP_011508882.1.92137 XP_016858800.1.92137 XP_016858801.1.92137 XP_016858802.1.92137 ENSP00000311320 ENSP00000386923 ENSP00000311320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]