SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386939 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386939
Domain Number 1 Region: 37-210
Classification Level Classification E-value
Superfamily Lysozyme-like 1.31e-24
Family G-type lysozyme 0.00000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386939   Gene: ENSG00000185674   Transcript: ENST00000409238
Sequence length 212
Comment pep:known chromosome:GRCh38:2:99242246:99254281:-1 gene:ENSG00000185674 transcript:ENST00000409238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFK
SGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
Download sequence
Identical sequences Q86SG7
ENSP00000327533 9606.ENSP00000327533 ENSP00000327533 ENSP00000386939 gi|31652255|ref|NP_783862.2| ENSP00000327533 ENSP00000386939 NP_783862.2.87134 NP_783862.2.92137 XP_016859240.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]