SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387083 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387083
Domain Number 1 Region: 19-65
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000745
Family Hairpin loop containing domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387083   Gene: ENSG00000183281   Transcript: ENST00000409795
Sequence length 89
Comment pep:known chromosome:GRCh38:2:87011172:87021852:-1 gene:ENSG00000183281 transcript:ENST00000409795 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFT
CRYFHRRCTYPEICNSDGHSNITVKSNNV
Download sequence
Identical sequences F8WCD6
ENSP00000387083 ENSP00000387083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]