SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387269 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000387269
Domain Number - Region: 20-46
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0116
Family Rhomboid-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387269   Gene: ENSG00000144468   Transcript: ENST00000409053
Sequence length 157
Comment pep:putative chromosome:GRCh38:2:226906712:226988498:1 gene:ENSG00000144468 transcript:ENST00000409053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQNVSNQQQNKHSQRVSFPPRTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVG
YPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRG
KPGHKETMASLLDPKIKVRTDKGPRCLGSLKQAAVWT
Download sequence
Identical sequences B9A054
ENSP00000387269 ENSP00000387269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]