SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387343 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387343
Domain Number 1 Region: 61-104
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000248
Family Hairy Orange domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387343   Gene: ENSG00000144485   Transcript: ENST00000409182
Sequence length 195
Comment pep:novel chromosome:GRCh38:2:238238605:238239958:-1 gene:ENSG00000144485 transcript:ENST00000409182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKVQAKLENAEVLELTVRRVQGVLRGRAREREQLQ
AEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSSFQDLLGDAL
AGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALG
SLTTAQIARSVWRPW
Download sequence
Identical sequences B9A070
ENSP00000387343 ENSP00000387343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]