SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387387 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387387
Domain Number 1 Region: 32-133
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.4e-35
Family LplA-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387387   Gene: ENSG00000144182   Transcript: ENST00000449211
Sequence length 135
Comment pep:known chromosome:GRCh38:2:99154977:99162363:1 gene:ENSG00000144182 transcript:ENST00000449211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGK
PILFFWQNSPSVVIGRHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTT
KKKYDRMENLKLIVR
Download sequence
Identical sequences C9JW10
ENSP00000387387 ENSP00000387387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]