SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387415 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387415
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000000000196
Family AlaX-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387415   Gene: ENSG00000266967   Transcript: ENST00000450475
Sequence length 84
Comment pep:known chromosome:GRCh38:17:42955855:42964482:-1 gene:ENSG00000266967 transcript:ENST00000450475 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDR
LPVNVRELSLDDPEVEQVRWPGFA
Download sequence
Identical sequences K7N799
ENSP00000387415 ENSP00000387415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]