SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387710 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387710
Domain Number 1 Region: 355-637
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.06e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000102
Further Details:      
 
Domain Number 2 Region: 178-354
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.1e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000902
Further Details:      
 
Domain Number 3 Region: 639-745
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.42e-27
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 144-176
Classification Level Classification E-value
Superfamily TGS-like 0.0000199
Family TGS domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000387710
Domain Number - Region: 83-112
Classification Level Classification E-value
Superfamily TGS-like 0.049
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387710   Gene: ENSG00000113407   Transcript: ENST00000455217
Sequence length 756
Comment pep:novel chromosome:GRCh38:5:33440965:33467838:1 gene:ENSG00000113407 transcript:ENST00000455217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISHTASCKNLSS
LASLLASVAIPSSGMPWPPLFFLQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDE
EAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCK
KIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVR
HTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDHRKIG
RDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG
HWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG
ALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLG
DIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQL
PIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVG
PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVN
IRTRDNKVHGERTISETIERLQQLKEFRSKQAEEEF
Download sequence
Identical sequences ENSP00000420893 ENSP00000387710 ENSP00000387710 NP_001245367.1.87134 NP_001245367.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]