SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387927 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387927
Domain Number 1 Region: 6-56
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000118
Family ZZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387927   Gene: ENSG00000152818   Transcript: ENST00000455022
Sequence length 186
Comment pep:known chromosome:GRCh38:6:144799381:144835938:1 gene:ENSG00000152818 transcript:ENST00000455022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEEEEWYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVLKN
KFRSKKYFAKHPRLGYLPVQTVLEGDNLETPSQSPQLFHDDTHSRIEQYATRLAQMERTN
GSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIA
DLEEEQ
Download sequence
Identical sequences Q5JT49
ENSP00000387927 ENSP00000387927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]