SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000388435 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000388435
Domain Number 1 Region: 19-185
Classification Level Classification E-value
Superfamily Integrin domains 8.37e-32
Family Integrin domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000388435   Gene: ENSG00000091409   Transcript: ENST00000416789
Sequence length 258
Comment pep:putative chromosome:GRCh38:2:172487962:172504328:1 gene:ENSG00000091409 transcript:ENST00000416789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFR
ESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILR
SRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGV
PWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYID
NLEKKQWITKWNENESYS
Download sequence
Identical sequences H7BZ97
ENSP00000388435 ENSP00000388435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]