SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389207 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389207
Domain Number 1 Region: 1578-1820
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 477-593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 588-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 276-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 354-479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000151
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 930-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 7 Region: 767-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000254
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 193-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 967-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 157-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 677-802
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000722
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 12 Region: 1046-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000073
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1252-1283
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 14 Region: 235-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.028
Further Details:      
 
Domain Number 15 Region: 1005-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000378
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 16 Region: 313-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family EGF-type module 0.01
Further Details:      
 
Domain Number 17 Region: 809-933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000769
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 30-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.025
Further Details:      
 
Domain Number 19 Region: 65-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000719
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 1215-1245
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 21 Region: 119-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSP00000389207
Domain Number - Region: 1174-1203
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1088-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00327
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 1133-1171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00599
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 625-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389207   Gene: ENSG00000232339   Transcript: ENST00000454571
Sequence length 2002
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MANN_CTG1:32234228:32263476:-1 gene:ENSG00000232339 transcript:ENST00000454571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGET
CQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLEDP
CPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCH
CPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPPR
GCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTCL
CPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIA
ATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQ
PGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLS
QPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICLP
GFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVG
ASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPP
EDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTGY
TGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGGT
CVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGSC
QTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLC
HNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGYD
GQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTA
ACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEG
PTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPCL
YNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGG
DCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHD
HFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSL
TLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAGF
VVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAPP
ANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRR
PPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGAL
PQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLLD
GGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADARE
VCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWA
AAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAGL
APADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPRC
RTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGMR
GPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGSP
QLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences A0A1U9X989
ENSP00000389207 ENSP00000389207 9606.ENSP00000389207 ENSP00000389207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]