SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389442 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389442
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Integrin domains 3.71e-31
Family Integrin domains 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389442   Gene: ENSG00000138448   Transcript: ENST00000430709
Sequence length 136
Comment pep:putative chromosome:GRCh38:2:186668877:186676283:1 gene:ENSG00000138448 transcript:ENST00000430709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQC
LKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIE
DITNSTLVSHWFRQIE
Download sequence
Identical sequences H7BZG1
ENSP00000389442 ENSP00000389442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]