SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389935 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389935
Domain Number 1 Region: 35-119
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.29e-26
Family Gamma-glutamyltranspeptidase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389935   Gene: ENSG00000100031   Transcript: ENST00000411974
Sequence length 120
Comment pep:known chromosome:GRCh38:22:24594814:24615107:1 gene:ENSG00000100031 transcript:ENST00000411974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN
Download sequence
Identical sequences E7ENJ5
ENSP00000389935 ENSP00000389935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]