SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389942 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389942
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.000000000494
Family MHC antigen-recognition domain 0.0000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389942   Gene: ENSG00000160862   Transcript: ENST00000419575
Sequence length 85
Comment pep:putative chromosome:GRCh38:7:99966731:99971994:-1 gene:ENSG00000160862 transcript:ENST00000419575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPMGLWRQQKYPGPARSSLCG
GHQPPGPRRKEETEVPGLRLLPREN
Download sequence
Identical sequences H7BZJ8
ENSP00000389942 ENSP00000389942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]