SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389965 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000389965
Domain Number - Region: 26-91
Classification Level Classification E-value
Superfamily Rhomboid-like 0.068
Family Rhomboid-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389965   Gene: ENSG00000136986   Transcript: ENST00000419562
Sequence length 151
Comment pep:novel chromosome:GRCh38:8:123015165:123042302:-1 gene:ENSG00000136986 transcript:ENST00000419562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQACYLPWVIL
GFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGF
GVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Download sequence
Identical sequences A0A1D5QL17 A0A2I2ZCY3 A0A2I3H184 A0A2I3MNU5 A0A2I3TRG7 A0A2J8X2Z3 A0A2K5MWV6 A0A2K5VNK7 A0A2K5XRR9 A0A2K6DIJ3 A0A2K6F8Y4 B4E1G1
ENSP00000389965 ENSP00000389965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]