SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000389979 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000389979
Domain Number 1 Region: 128-262
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.19e-28
Family Toll/Interleukin receptor TIR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 20-122
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-23
Family DEATH domain, DD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000389979   Gene: ENSG00000172936   Transcript: ENST00000424893
Sequence length 264
Comment pep:novel chromosome:GRCh38:3:38138552:38141660:1 gene:ENSG00000172936 transcript:ENST00000424893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADW
TALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP
SIGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELI
EKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFIT
VCDYTNPCTKSWFWTRLAKALSLP
Download sequence
Identical sequences A0A0A0MSI9
NP_001166039.1.87134 NP_001166039.1.92137 ENSP00000389979 gi|289546581|ref|NP_001166039.1| ENSP00000389979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]