SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390721 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390721
Domain Number 1 Region: 150-218
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000192
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390721   Gene: ENSG00000010295   Transcript: ENST00000436152
Sequence length 256
Comment pep:known chromosome:GRCh38:12:6538375:6551900:-1 gene:ENSG00000010295 transcript:ENST00000436152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNLSELDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNCEDMIQMFQKKLVPSMGGR
KRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCDSLTW
EETEETLLLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTREKEYQETIDQIELE
LATAKNDMNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPS
EAEDSDRDVSSDSSMR
Download sequence
Identical sequences F8W8H2
ENSP00000390721 ENSP00000482340 ENSP00000390721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]