SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000390879 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000390879
Domain Number 1 Region: 15-44
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000012
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000390879   Gene: ENSG00000152818   Transcript: ENST00000433557
Sequence length 47
Comment pep:putative chromosome:GRCh38:6:144285701:144403184:1 gene:ENSG00000152818 transcript:ENST00000433557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSK
Download sequence
Identical sequences Q5SYY2
ENSP00000390879 ENSP00000390879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]