SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391232 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000391232
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000314
Family Rhomboid-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391232   Gene: ENSG00000005486   Transcript: ENST00000428119
Sequence length 223
Comment pep:known chromosome:GRCh38:7:75882044:75888921:1 gene:ENSG00000005486 transcript:ENST00000428119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQTSFLSNVCGLSIGLAYGLTYC
YSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERRAAQSRKLNPVPGSYPTQSCHP
HLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPASGLCYVQNHFGPNPTSSSVYP
ASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVPMP
Download sequence
Identical sequences A0A2I3TXI6
gi|94818879|ref|NP_001035547.1| ENSP00000314144 ENSP00000391232 ENSP00000314144 ENSP00000391232 ENSP00000458798 ENSP00000461474 NP_001035547.1.87134 NP_001035547.1.92137 XP_003318573.1.37143 XP_005250568.1.92137 XP_008959315.1.60992 XP_016814285.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]