SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391450
Domain Number 1 Region: 83-134
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000532
Family RecA protein-like (ATPase-domain) 0.017
Further Details:      
 
Domain Number 2 Region: 18-65
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0000188
Family DNA repair protein Rad51, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391450   Gene: ENSG00000108384   Transcript: ENST00000421782
Sequence length 135
Comment pep:putative chromosome:GRCh38:17:58692628:58695336:1 gene:ENSG00000108384 transcript:ENST00000421782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALET
LQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKT
TEICGAPGVGKTQLW
Download sequence
Identical sequences NP_002867.1.87134 NP_002867.1.92137 ENSP00000391450 gi|4506391|ref|NP_002867.1| ENSP00000391450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]