SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000391753 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000391753
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-26
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 2 Region: 172-314
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-26
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000391753   Gene: ENSG00000172936   Transcript: ENST00000421516
Sequence length 316
Comment pep:novel chromosome:GRCh38:3:38138665:38143022:1 gene:ENSG00000172936 transcript:ENST00000421516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPDRAEAPGPPAMAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWT
ALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPS
IEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYC
PSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRLARRPRGGCRRMV
VVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC
TKSWFWTRLAKALSLP
Download sequence
Identical sequences H0Y4G9
ENSP00000391753 ENSP00000391753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]