SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392221 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392221
Domain Number 1 Region: 146-302
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.29e-28
Family Dual specificity phosphatase-like 0.00094
Further Details:      
 
Domain Number 2 Region: 3-152
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.01e-17
Family Cell cycle control phosphatase, catalytic domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392221   Gene: ENSG00000127952   Transcript: ENST00000431581
Sequence length 313
Comment pep:known chromosome:GRCh38:7:75996409:76047953:-1 gene:ENSG00000127952 transcript:ENST00000431581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEY
LLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLT
HHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPK
IQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGS
VILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTI
LGDSITNIMDPLY
Download sequence
Identical sequences A0A024R4L1 Q9Y6J8
ENSP00000248600 ENSP00000352726 ENSP00000392221 ENSP00000459989 ENSP00000460994 ENSP00000461408 9606.ENSP00000248600 NP_001304714.1.87134 NP_001304714.1.92137 NP_001304715.1.87134 NP_001304715.1.92137 NP_057170.1.87134 NP_057170.1.92137 XP_011514595.1.92137 ENSP00000248600 ENSP00000458198 gi|7706363|ref|NP_057170.1| ENSP00000248600 ENSP00000352726 ENSP00000392221 GO.42661 NYSGXRC-8670a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]